SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002447 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002447
Domain Number 1 Region: 39-797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.77e-264
Family Motor proteins 0.000000000259
Further Details:      
 
Domain Number 2 Region: 1960-2076
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-22
Family Second domain of FERM 0.0027
Further Details:      
 
Domain Number 3 Region: 1253-1356
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.11e-20
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 4 Region: 2077-2167
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-20
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 1860-1968
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000106
Family First domain of FERM 0.088
Further Details:      
 
Domain Number 6 Region: 1348-1442
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000209
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 7 Region: 1569-1639
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000456
Family SH3-domain 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000002447
Domain Number - Region: 796-864
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000584
Family Motor proteins 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002447   Gene: ENSSTOG00000002703   Transcript: ENSSTOT00000002736
Sequence length 2181
Comment pep:novel scaffold:spetri2:JH393308.1:5762869:5824007:1 gene:ENSSTOG00000002703 transcript:ENSSTOT00000002736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPQGDYVWMDLRSGQEFDVPIGAVVKLCDSGQIQVVDDEGNEHWISPQNATHIKPMHPT
SVHGVEDMIRLGDLNEAGILRNLLIRYRDHLIYTYTGSILVAVNPYQLLSIYSPEHIRQY
TNKKIGEMPPHIFAIADNCYFSMKRNSRDQCCIISGESGAGKTESTKLILQFLAAISGQH
SWIEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNTRGAIEGAKIEQYLLEKSRV
CRQCPSLAGAHLPVLLHCGSPSSPVQPLAKIGLGQATDYNYLAMGNCITCEGRVDSQEYA
NIRSAMKVLMFTDTENWEISKLLAAILHLGNLQYEARTFENLDACEVLFSPSLTTAASLL
EVNPPDLMSCLTSRTLITRGETVSTPLSMEQALDVRDAFVKGIYGRLFVWIVDKINVAIY
KPPSQEVKNSRRSIGLLDIFGFENFTVNSFEQLCINFANEHLQQFFVRHVFKLEQEEYDL
ESIDWLHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDTTMLYKLNSQHKLNNNYV
PPKNNHETQFGINHFAGIVYYETQGFLEKNRDTLHGDIIQLVHSSRNKFIKQIFQADVAM
GAETRKRSPTLSSQFKRSLELLMRTLGACQPFFVRCIKPNEFKKPMLFDRHLCVRQLRYS
GMMETIRIRRAGYPIRYSFVEFVERYRVLLPGVKPAYKQGNLRGTCQRIAEAVLGTHDDW
QIGKTKIFLKDHHDMLLEVERDKAITDRVILLQKIIRGFKDRSNFLKLKNAATLIQKHWR
GYTCRRNYELMRLGFLRLQALHRTRKLHQQYCLARQRIIQFQARCRAYLVRKAFRHRLWA
VLTVQAYARGMIARRLHRRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQE
RLAQLACEDAERELKEKEAARQKKELLEQMEKARHEPINHSDMVDKMFGFLGTSGGLPGQ
EGQAPSGFEDLEQGRTEMVEEDVDVALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTR
RPLKQPLLYHDDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLG
KKTYKRELQALQGESEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQG
NSMLEDRPTSNLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCV
GCFAPSEKFVKYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIM
LPVTFMDGTTKTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHV
MDAISQCEQYAKEQGAQERNAPWRLFFRKEVFTPWHNPSEDNVATNLIYQQVVRGVKFGE
YRCEKEDDLAELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAH
KKGIYAQRRTDAQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGIY
FVDEQEQVLLELSFPEIMAVSSSRGAKLTVPSFTLATIKGDEYTFTSNNAEDIRDLVVTF
LEGLRKRSKYVVALQDNPNPAGEESGFLSFAKGDLIILDHDTGEQVMNSGWANGINERTK
QHGDFPTDCVYVMPTVTMPPQEIVALVTMTPDQRQDVIRLLQLRTAEPEVRAKPYTLEEF
SYDYFRPPPKHTLSRVMVSKARGKDRLWSHTREPLKQALLKKILGSEELSQEACMAFIDI
HAALGYMGDYPSKRMRSVNELTDQIFEGALKAEPLKDEAYVQILKQLTDNHIRYSEERGW
ELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAIDCLQRLQKALRNGSRKYPPHLVEVEA
IQHKTTQIFHKVYFPDDTDEAFEVESSTKAKDFCQNIAARLLLKSSEGFSLFVKIADKVI
SVPENDFFFDFVRHLTDWIKKARPIKDGVVPSLTYQVFFMKKLWTTTVPGKDPMADSIFH
YYQELPKYLRGYHKCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQISP
DDWKRSIVAYFNKHAGKSKEEAKLAFLRLIFKWPTFGSAFFEVKQTTEPNFPEILLIAIN
KYGVSLIDPRTKDILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLL
TSYISQMLTAMSKQRGSRSGK
Download sequence
Identical sequences ENSSTOP00000002447 ENSSTOP00000002447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]