SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002489 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002489
Domain Number 1 Region: 244-605
Classification Level Classification E-value
Superfamily SIS domain 2.41e-104
Family double-SIS domain 0.000000511
Further Details:      
 
Domain Number 2 Region: 3-130,171-215
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.12e-41
Family Class II glutamine amidotransferases 0.0000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002489   Gene: ENSSTOG00000002766   Transcript: ENSSTOT00000002782
Sequence length 605
Comment pep:novel scaffold:spetri2:JH393549.1:508931:542415:1 gene:ENSSTOG00000002766 transcript:ENSSTOT00000002782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHNGIITNYKDLRKFLESKGYE
FESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEGAFALVFKSIHYPGEAVATR
RGSPLIIGVRSKYKLSTEQIPILYRTCNIENVKNICKTRMKRLDSSTCLHAVGDKAVEFF
FASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSASDDPSRAIQTLQMELQQIMK
GSCNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGT
SYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYC
KDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYTSQFISLVMFGLMMSEDR
ISLQSRRQEIIRGLRSLPELIKEVLSLDEKIHDLALELYTQRSLLVMGRGYNYATCLEGA
LKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRP
IILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAK
SVTVE
Download sequence
Identical sequences ENSSTOP00000002489 ENSSTOP00000002489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]