SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003113 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003113
Domain Number 1 Region: 33-138
Classification Level Classification E-value
Superfamily Second domain of FERM 6.67e-38
Family Second domain of FERM 0.0000425
Further Details:      
 
Domain Number 2 Region: 136-196
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-18
Family Third domain of FERM 0.005
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000003113
Domain Number - Region: 1-32
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0599
Family First domain of FERM 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003113   Gene: ENSSTOG00000003468   Transcript: ENSSTOT00000003478
Sequence length 197
Comment pep:novel scaffold:spetri2:JH393341.1:6522750:6542240:-1 gene:ENSSTOG00000003468 transcript:ENSSTOT00000003478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YWLDPAKTLAEHKELINTGPPYTLYFGIKFYAEDPCKLKEEITRYQFFLQVKQDVLQGRL
PCPVNIAAQLGAYAIQSELGDYDPYKHTAGYVSEYRFVPDQKEELEEAIERIHKTLMGQA
PSEAELNYLRTAKSLEMYGVDLHPVYGENKSEYFLGLTPVGVVVYKNKKQVGKYFWPRIT
KVHFKETQFELRVLGKD
Download sequence
Identical sequences ENSSTOP00000003113 ENSSTOP00000003113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]