SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003119 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003119
Domain Number 1 Region: 178-419
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-87
Family Eukaryotic proteases 0.00022
Further Details:      
 
Domain Number 2 Region: 88-186
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000432
Family Hepsin, N-terminal domain 0.041
Further Details:      
 
Domain Number 3 Region: 40-79
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003119   Gene: ENSSTOG00000003485   Transcript: ENSSTOT00000003484
Sequence length 420
Comment pep:novel scaffold:spetri2:JH393352.1:3201471:3214982:1 gene:ENSSTOG00000003485 transcript:ENSSTOT00000003484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DATTLRKPRTPLETFRKVGIPIIAVLLSLATIIIVVILIKVILDKYYFICGHPLHFLPRT
QMCDGHPDCASGEDEEPCVKDFPERPAVGVRLSKDRSTLQVLDPATGNWASACFDNFTET
LAKTACGQMGYSSQPTFKAVEIGPDQDLDVVKVTEDSQELQVRNSSGPCLSGSLVALHCL
ACGRSLKAPRVVGGEEASVDSWPWQVSLQYNKQHVCGGSILDPQWILTAAHCFRNYRDVS
NWKVRVGSEKLSSFPSLPVAKIFTTEHNTLYPKEKDIALMKLENPLTFSGTIRPICLPFF
DEELAPATQLWVVGWGFTEENGGKMSDTLLQASVQVIDHTRCNADDAYQGEVTEKMLCAG
VPGGGVDTCQGDSGGPLMYKSDHWKVVGIVSWGHGCGGPSTPGVYTKVTAYLDWIYSVWK
Download sequence
Identical sequences ENSSTOP00000003119 ENSSTOP00000003119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]