SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003449 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003449
Domain Number 1 Region: 22-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.06e-38
Family CRAL/TRIO domain 0.0024
Further Details:      
 
Domain Number 2 Region: 255-394
Classification Level Classification E-value
Superfamily PapD-like 7.06e-38
Family MSP-like 0.000000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003449   Gene: ENSSTOG00000003840   Transcript: ENSSTOT00000003846
Sequence length 455
Comment pep:novel scaffold:spetri2:JH393280.1:4330713:4372290:1 gene:ENSSTOG00000003840 transcript:ENSSTOT00000003846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDESFQWRKEFSVNDLNESSIPRWLLEIGGIYLHGYDKEGNKLFWIRVKYHIKDQKTIL
DKKKLIAFWLERYAKRENGKPITVMFDLSETGLNSIDMDFVRFIINCFKVYYPKYLSKMV
IFDMPWIMNAAFKIVKSWLGPEAVSLLKFTSKNEVQDYVSVEYLPPHMGGTDPFKYSYPP
LVDDDFQTPLCENGPIASEDETSSKEDIESDGKETLETISNEEQTALLKKTNPAESTPKT
EESEKVDSKLKTFKKPLSVFKGPLLHISPAEELYFGSTESGEKKTLIVLTNVTKNIVAFK
VRTTAPEKYRVKPSNSSCDPGASVDIVVSPHGGLTVSAQDRFLIMAAEMEQPSGTGPAEL
TQFWKEVPRNKVMEHRLRCHTVESNKPNTLTLKDSALNMSDKTSEDIYLQLNRLLESNRK
LEDQVQRCIWFQQLLLALTMLLLAFAVSFFYSLYS
Download sequence
Identical sequences ENSSTOP00000003449 ENSSTOP00000003449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]