SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003615 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003615
Domain Number 1 Region: 26-362
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.59e-61
Family WD40-repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 359-405
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000105
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003615   Gene: ENSSTOG00000004036   Transcript: ENSSTOT00000004031
Sequence length 406
Comment pep:novel scaffold:spetri2:JH393368.1:4720514:4747528:1 gene:ENSSTOG00000004036 transcript:ENSSTOT00000004031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPATEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLE
EQFIPKGFEAKSRSSKNDTKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQV
PDISCLILATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTL
RIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGH
QSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQLEPAMDDSDVHMSSLRS
VCFSPEGLYLATVADDRLLRIWALELKAPVAFAPMTNGLCCTFFPHGGVIATGTRDGHVQ
FWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF
Download sequence
Identical sequences XP_005329692.1.77405 XP_015358022.1.40921 ENSSTOP00000003615 ENSSTOP00000003615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]