SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003812 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003812
Domain Number 1 Region: 270-378
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-25
Family SH2 domain 0.000000557
Further Details:      
 
Domain Number 2 Region: 382-422
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000314
Family SOCS box-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003812   Gene: ENSSTOG00000004262   Transcript: ENSSTOT00000004245
Sequence length 434
Comment pep:novel scaffold:spetri2:JH393507.1:111746:113047:-1 gene:ENSSTOG00000004262 transcript:ENSSTOT00000004245 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SENNSKNIDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSESCSDAETVDTIEKTEVPLRS
QERNHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKRKIHI
SELMLDKCPFPPRSDLAFRWHFIKRHTAPISPKSDEWVSTDLSQSELRDGQLKRRNLEDV
NCFSHTNVQPCVVTTNNASCRGGPMTGSMMNLGPNNSIEDSDMDSDDEIITLCTSSRKRN
KPKWEMDDDILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEALLEGKPE
GTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYK
DPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPTSMKLYLKEYHYK
SKVRVLRIDAPEQQ
Download sequence
Identical sequences ENSSTOP00000003812 ENSSTOP00000003812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]