SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004001 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004001
Domain Number 1 Region: 56-194
Classification Level Classification E-value
Superfamily PH domain-like 0.000000492
Family Phosphotyrosine-binding domain (PTB) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004001   Gene: ENSSTOG00000004464   Transcript: ENSSTOT00000004458
Sequence length 200
Comment pep:novel scaffold:spetri2:JH393342.1:5802967:5809591:-1 gene:ENSSTOG00000004464 transcript:ENSSTOT00000004458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNLDTC
AEFRVKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPLEEEFIMGVSKYGIK
VSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCHSLEQA
QAICKVLSTAFDAVLTSEKS
Download sequence
Identical sequences A0A287CY63
ENSSTOP00000004001 XP_013215046.1.77405 XP_021583442.1.77405 ENSSTOP00000004001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]