SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004259 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004259
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000247
Family Eukaryotic type KH-domain (KH-domain type I) 0.0035
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000144
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004259   Gene: ENSSTOG00000004732   Transcript: ENSSTOT00000004744
Sequence length 614
Comment pep:novel scaffold:spetri2:JH393390.1:5168884:5188309:-1 gene:ENSSTOG00000004732 transcript:ENSSTOT00000004744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSATHPGAGGRRSKWDQPAPAPLLFLPPAAPGGEVSSSGGSPGGATAAPSGALDAAA
AVAAKINAMLMAKGKLKPTQNAAEKLQAPGKGLTSNKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPITQLSPAVSQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQSSAISSVPPQPPYYPSNGY
QSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPAST
GQSPMSGPFIPAAPVKTALPAGPQPQPQPQPPLPTQPQAQKRRFTEELPDERESGLLGYQ
HGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQLMPPPAFPVTGIKTESDERNG
SGTLTGSHDYPAKKMKTTEKGFGLVAYAADSSDEEEEHGGHKNASSFPQGWSLGYQYPSS
QPRAKQQMPFWMAP
Download sequence
Identical sequences I3M4T3
XP_005331424.1.77405 ENSSTOP00000004259 ENSSTOP00000004259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]