SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004343 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004343
Domain Number 1 Region: 227-478
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.98e-57
Family Voltage-gated potassium channels 0.00083
Further Details:      
 
Domain Number 2 Region: 7-39,92-162
Classification Level Classification E-value
Superfamily POZ domain 6.28e-28
Family Tetramerization domain of potassium channels 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004343   Gene: ENSSTOG00000004842   Transcript: ENSSTOT00000004838
Sequence length 640
Comment pep:novel scaffold:spetri2:JH393378.1:3511087:3692736:-1 gene:ENSSTOG00000004842 transcript:ENSSTOT00000004838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKIENNERVILNVGGTRHETYRSTLKTLPGTRLALLAASEPQGDCLTAAGDKLQPLPPP
LSPPPRPPPLSPGPGGCFEGGAGNCSSHGGSGGGSDHPAGGREFFFDRHPGVFAYVLNYY
RTGKLHCPADVCGPLFEEELAFWGIDETDVEPCCWMTYRQHRDAEEALDIFETPDLIGGD
PGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWALFEDPYSSRAARFIAFASLFF
ILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIETDPALTYVEGVCVVWFTFEFL
VRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRI
FKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERVGAQPNDPSASEH
TQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCALAGVLTIAMPVPVIVNNFGM
YYSLAMAKQKLPRKRKKHIPPAPQASSPTFCKTELNVACNSTQSDTCLGKDNRLLEHNRS
VLSGDDSTGSEPPLSPPERLPIRRSSTRDKNRRGETCFLLTTGDYTCASDGGIRKGYEKS
RSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Download sequence
Identical sequences I3M4Y8
ENSSTOP00000004343 XP_005330483.1.77405 XP_015338471.1.40921 XP_021585587.1.77405 ENSSTOP00000004343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]