SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004396 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004396
Domain Number 1 Region: 40-269,368-514
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.82e-62
Family FAD-linked reductases, N-terminal domain 0.00000000000294
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.16e-37
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.000000841
Further Details:      
 
Domain Number 3 Region: 516-615
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.48e-29
Family ETF-QO domain-like 0.00000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004396   Gene: ENSSTOG00000004905   Transcript: ENSSTOT00000004902
Sequence length 617
Comment pep:novel scaffold:spetri2:JH393386.1:5140846:5165323:1 gene:ENSSTOG00000004905 transcript:ENSSTOT00000004902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVRLAKLSCPAYHCFHALKIKKNYLPLCATRWSSTSVVPQITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAIRLKQLAAEHEKDIRVCLVEKAAQIGAHTLSGACLD
PCAFQELFPDWKERGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEILFHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAK
VTVFAEGCHGHLAKQLYKKFDLRANCDPQTYGIGLKELWIIDEKKWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGFVVGLDYQNPYLSPFREFQRWKHHPSIQPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFLNVPKIKGTHTAMKSGSLAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKKSWVWKELYSVRNIRPSCHGALGLYGGMIYTGIFYWILRG
MEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLK
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM
Download sequence
Identical sequences I3M531
ENSSTOP00000004396 XP_005330997.1.77405 ENSSTOP00000004396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]