SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004689 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004689
Domain Number 1 Region: 922-1138
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-35
Family DBL homology domain (DH-domain) 0.0023
Further Details:      
 
Domain Number 2 Region: 1294-1490
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-29
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 1125-1242
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-22
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004689   Gene: ENSSTOG00000005202   Transcript: ENSSTOT00000005226
Sequence length 1492
Comment pep:novel scaffold:spetri2:JH393412.1:434842:484014:1 gene:ENSSTOG00000005202 transcript:ENSSTOT00000005226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQPKKHGAEPRLPHSFFCSDSSDSPKPPLAPKPRTSSPRAPGVAPPLAASPHLRLRSPPR
APRGPKPPIADPGDGRPGVCVGDSVTKCRNGRLLCVDPGLDPGRQSETDEDDMEVPRVVA
RDGSCVENVASEEPPGDPGEEEQEAGGAGEDPAEGTPSGEGEGHTGDIPDNEEEDSEDAP
GTEEQGSTSEEEEKRVKAHNAYNLGARGPWDTGDISEDDIILTHVDAEAPEVPCEEPEAP
GEEGAQEDGEEDPVGAEPGGLHEAGDPDGAAQDTGQDVADDSEGAQEAEELGPAIQGTET
ASDSLETPEGQEEQEEDGEVDEEGEGGPDGGDQGDQGDQEEAPDQGQRAAEEGPLEGEDP
AQDEATEDGCQIVPFESDSLDDFVTSLTGSPYAFLPTESTSFCSDSYSQVPEPGREPGAQ
GLCAVDAPQLPGDAADGLSIPDVVVVPEDEEDVADDSLSNPYVVAVGLPSPGDPGGGGQP
ETPATPDGADGPDGTEEASSAAEGGLVPSDWKGLATRARPHSGKVAGYVPETVLEEAGPE
AGPSGSGTAEAAEESRWPLDARPPDGSRALPAKPRAFALYPRSFSVEGREVPVGLFREPD
GPGLDDVRIQRKDDNLSLPCVIGSSGSFSQRHHLPSSGTSTPSSVVDIPPPFDLACITKK
PITKSSPSLLLDSESPDKATKKKKSSFKRFLALTFKKKSESKAHGDLSAPSSRSSSESSY
HGPPRLLDMERRSFGNSPQLKSRAAKLRACESPSSLLFYRDSRRKGIPLSRTVSRVESFE
DRSRPPFLPLPLTKPRSISFPNADTSDYENIPAGNSDYENIQIPPRRPARAATFTKLFEE
QSRALATANENDGYVDMSSFNAFDNRQQSAEFSKEPAYTEPYKVCAVSAVAPKEDVTSDE
EQGSSEEEDGVPRDPGLTHKGEGQSRALVVAQELLASEKAYVQALQHLRRDFHGAVLRAL
DDMDQEGRDALAREELRQGLSELPAIHDLHQGILEELEDRLSNCREGQQKVADVFLAREQ
EFAHHAAHILQFDRNLALLAENCLLSPRLAAAVREFEQGQHGGGQSAKHRLLRVVQRLFQ
YQVLLTDYLNNLRPDSAEYEDTQGALSLISKVTDRANDSMEQGENLQKLVHIDHSVRGQG
DLLQPGREFLKEGTLAKVRGKSRHPRHLFLMSDVLLYTYPQKDGKYRLKSSLAVANMKVS
RPVMEKVPYALKIEVPECCLLLSASSCAERDEWYSCLSRALPEDYKAQALAAFHHSVEIR
ERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKYPLRYL
KDRMAKVCDGCYGELKKRGGAVPGPLRERPMSMSFPLTSARFSSGSALSAVFPSTFKKQK
KVPSALTEVTASGEGSAISGYLSRCKRGKRHWKKLWFVIKGKVLYTYVASEDKVALESMP
LLGFTIAPEKEGGEAGPVFHLYHKKTLFYSFKAESAGVAQRWMQAMEDASVL
Download sequence
Identical sequences ENSSTOP00000004689 ENSSTOP00000004689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]