SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004836 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004836
Domain Number 1 Region: 299-413
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-33
Family Spermadhesin, CUB domain 0.00053
Further Details:      
 
Domain Number 2 Region: 143-252
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 3 Region: 464-576
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.44e-27
Family Frizzled cysteine-rich domain 0.00031
Further Details:      
 
Domain Number 4 Region: 258-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000128
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 5 Region: 419-458
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004836   Gene: ENSSTOG00000005406   Transcript: ENSSTOT00000005404
Sequence length 579
Comment pep:novel scaffold:spetri2:JH393352.1:4272264:4277001:-1 gene:ENSSTOG00000005406 transcript:ENSSTOT00000005404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEYSDVILCMEATELSKTEFCNPAFEPEAGLPGPSAALRQDASHNIQAPWHGRRPRGLQ
PDCHFSWLCILLLASLLLLLLGLLAAIILSQLPAAPPPGATKSPLPAQGLTTTTTPTTST
STTSSATSGQQGADASPAHQATCGGLLPGPRGFFSSPNYPDPYPPNAHCVWHIQVATDHT
IQLKIEALSVEGVAACLFDRLEISPEPEGPLLRVCGKVPPPTLNTNASRLQVAFVSDSSV
EGSGFQAWYQAVAPGHGSCAHEEFHCDQLVCLLPDSVCDGFANCADGSDETNCSAKLLGC
GGNLTGLQGTFSTPSDLQQHPHQQLCTWHISVPVGHGIELQFWNFSLEAQDECKFDYVEV
YETSSSGALSLLGRFCGAETPPHLVSSHHELAVLFRTDHSISSGGFSATFKAFNATENPC
GPRKFLCQNGGCRDLQWMCDLWRDCIDGNNDKNCSSPLLPPPELACEPVQVEMCIGLSYN
TTAFPNIWVGMATQEEVVDVLRGYKSLTSLPCYQNFRRLLCGLLVPRCTLLGSVLPPCRS
VCQEAERQCQSGLALLGTPWPFNCNRLPEAAGLEACAQP
Download sequence
Identical sequences I3M604
ENSSTOP00000004836 ENSSTOP00000004836 XP_005328429.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]