SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005774 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005774
Domain Number 1 Region: 16-60
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000196
Family Elafin-like 0.0014
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Elafin-like 0.00000017
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005774   Gene: ENSSTOG00000006455   Transcript: ENSSTOT00000006458
Sequence length 109
Comment pep:novel scaffold:spetri2:JH393324.1:7234696:7236301:1 gene:ENSSTOG00000006455 transcript:ENSSTOT00000006458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLKALLAFGFLASWVTAEEHVKEGECPPDKNPCKELCQDDESCPPGQKCCSTGCGQVCRE
YIPIGMKRICPRIVRKRSCFKSCTTDDTCPGVKKCCTFGCSTACVAPVS
Download sequence
Identical sequences ENSSTOP00000005774 ENSSTOP00000005774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]