SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000007986 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000007986
Domain Number 1 Region: 1955-2113
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000000628
Further Details:      
 
Domain Number 2 Region: 1794-1954
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.17e-54
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.000000264
Further Details:      
 
Domain Number 3 Region: 1471-1648
Classification Level Classification E-value
Superfamily Cupredoxins 3.58e-49
Family Multidomain cupredoxins 0.0000273
Further Details:      
 
Domain Number 4 Region: 350-533
Classification Level Classification E-value
Superfamily Cupredoxins 1.46e-44
Family Multidomain cupredoxins 0.000043
Further Details:      
 
Domain Number 5 Region: 29-204
Classification Level Classification E-value
Superfamily Cupredoxins 1.87e-44
Family Multidomain cupredoxins 0.000000118
Further Details:      
 
Domain Number 6 Region: 1658-1794
Classification Level Classification E-value
Superfamily Cupredoxins 7.98e-35
Family Multidomain cupredoxins 0.00000141
Further Details:      
 
Domain Number 7 Region: 540-668
Classification Level Classification E-value
Superfamily Cupredoxins 4.85e-33
Family Multidomain cupredoxins 0.00026
Further Details:      
 
Domain Number 8 Region: 207-329
Classification Level Classification E-value
Superfamily Cupredoxins 6.47e-32
Family Multidomain cupredoxins 0.00000208
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000007986   Gene: ENSSTOG00000008897   Transcript: ENSSTOT00000008913
Sequence length 2114
Comment pep:novel scaffold:spetri2:JH393291.1:17114295:17178844:1 gene:ENSSTOG00000008897 transcript:ENSSTOT00000008913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGCPHLWVLVVLGSCWAGWGRHRADAAQLRQFYVAAQGINWNYHPEHSNLSSNPFTTF
FKKIVYREYEAYFKKEKPQSSISGLLGPTLYAEVGDIMKVHFKNKADKPLSIHPQGVKYS
KFSEGASYPDHTSPVEQMDDAVAPGQEYTYEWHIGEDSGPTQDDPPCLTHIYYSYVNLIQ
DFNSGLVGPLLICKKGTLTEDGTQKMFDRQHILLFAVFDESKSWAQSSSLMYTVNGYVNR
TMPDIAVCAHDHVSWHLIGMSSGPELFSIHFNGQVLEQGHHKVSVLNLASATSTTANMTM
SSEGKWIISSFIPKHFQAGMQAYIDVKNCPKKTRNPKKLTRDQRRHIKRWEYFIAAEEVI
WDYAPIIPANMDKKYRSLHLDNFSNQIGKYYKKVVYKQYQDETFTKRVENSNIKEEGILG
PIIRAQVRDTLKIVFKNMASRVYSIYPHGVTFSPYEDEVNSSYTSGSHTMIRAVQPGETY
TYKWNILELDEPTENDAQCLTRPYYSDVDVTRDIASGLIGLLLICKSRSLDKRGIQKAAD
IEQQAVFAVFDENKSWYIEDNINKFCENPDEVKRDDPKFYQSNIMSTLTLSAINGYVPES
IPTLGFCFDDTVQWHFCSVGTQDDILTIHFTGHSFIYEKRHEDTLTLFPMRGESVTVTMD
NVGTWMITTMNSNPRSKNLKLRFRDVKCIRDDDDDSYDFYEPIAPTVMGTRKMHDSSENK
QEEDNPDYDYQDKLASEFGIRSFRNSSLNQEEDEFNLTALALEDSSEFIFPSRDTAIGSN
SSSPSNVSRLIANNLTEPQKTLPHPGATRVDPPRRYLVGLGENSVINSSMTEHSSPYSED
PLEDHLQSDVTGISLLPPGAKGLRSPERDQVAKHRFSWMKLPAYKFGRHLNHGNTSSRRK
PWKELPSEPLLLKQKNPSKTLNGKWHLVSEKGSYEIIQDTDEDVAVGKLPNNPQNVSRMW
GGSIPPIDKPNKPSDHPKFPGVRHKSLQIRQDGGNSGLKKRPFLIRTRKKKKEEKLAYHV
PLSPRGFNPLREKSYNTFSERIFDHSLLPPKSNETSLLEELNQTSTSANFGWTVSLLDHN
QNTPNNTSQTSYHPDLSQTVTPEEHYHTFPIQDPDGTHSTADPSHRSSPPELSQMLDYDL
SHEFHPADTGHMSPSLEPEGWQTTLSPDPNYPFLYSDQGQMTSSSPDLSKTTPSPDLSQI
AVPPVLYQMPPSPDLSQTTPSLDLGQRTLSPELGQTSLDPDEGQITLSPELGQINLDPDL
DGMTLSPELGQTNLDPYGGQVALSPELGQTNLDPDEDQITLSPELGQINLDPNGGQMPLS
PGLSQMTLSPDLGQTIHLPKLSPTLPPPDLDHTAYPSESNQLLPLSEFSQTFPYPDSVHM
PSPLPSPTLGDAFVSEEFNPLVVVGLSGDDGDYIEIIPRKEVQSIEEDYVEVEYVAYDDP
YQTDTRTDINSSRNPDSIAAWYLRSNNGNRKYYYIAAEEISWDYSKFAQSEMDNEDTDDI
REDTTYKKVVFRKYLDSTFTKRDPQGEYEEHLGILGPVIRAEVDDVIQVRFKNLASRPYS
LHAHGLSYEKSSEGKTYEDDSPEWFKEDNAIQPNSSYTYVWHATERSGPESPGSACRAWA
YYSAVNPEKDVHSGLIGPILICRKGTLHKESNMPMDMREFVLLFMVFDEKKSWYYEKSKG
SQRRESSEVKNSHEFHAINGMIYNLPGLRMYEQEWVRLHLLNMGSSQDIHVVHFHGQTLL
EHGTQKHQLGVWPLLPGTFKTLEMKASKPGWWLLDTEVGENQRAGMQTPFLIIDKECKMP
MGLSTGVISDSQIKASEYLSYWEPKLARLNNAGSYNAWSVEKIATEFASKPWIQVDMQKE
VVVTGIQTQGAKHYLKSCYTTEFQVAYSSDQTNWQIFKGNSTKNVMYFDGNSDASTIKDN
KFDPPIVARYIRIFPTRSYNRPTLRLELQGCEVNGCSTPLGMESGKIENKQITASSFKKS
WWGDYWEPSLARLNAQGRVNAWQAKANNNKQWLQIDLLKIKKITAIVTQGCKSLSSEMYV
KSYTIYYSDQGVEWKPYRQKSSIVDKIFEGNSNIKGHVKNFFNPPIISRFIRIVPKTWNQ
SIALRLELFGCDIY
Download sequence
Identical sequences I3MCJ5
ENSSTOP00000007986 ENSSTOP00000007986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]