SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009923 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009923
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000422
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 504-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000147
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 735-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000476
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 553-580
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000326
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 643-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000118
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 6 Region: 798-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000266
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number 7 Region: 597-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000687
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000009923
Domain Number - Region: 169-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00428
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009923   Gene: ENSSTOG00000011050   Transcript: ENSSTOT00000011061
Sequence length 903
Comment pep:novel scaffold:spetri2:JH393324.1:11159416:11165202:-1 gene:ENSSTOG00000011050 transcript:ENSSTOT00000011061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLQGSSRSGPGKSGSRKEVRLPMLQDSPKLGMPVVHSGQTVSGQAPLCF
DPGSPASDRTEGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNSGCWLEFPSI
YGLKYHYQRCQGVRGYGSGRRWPRGVPGQRPGPRPTPALPAQGAISDRLAFPCPFCEAAF
TSKTQLEKHRIWNHMDRPLPAPKPGPVSRPVSISRPVGVSKPIGVSKPVTMGKPVGVSRP
IGISKPVTVSRPVPVTRPMPVTKPVTVSRPMPVTKAMPVTKAMPVTRPVPVTKPIPVTKL
VTITKPVPVSKPVPVSRPVVVSKPVPVSRPIAISRHTPTCKMVLLTKSENKAPRAAGKSS
SKKRAADSLDICPIPPKQSRPENGEFSPSTTDQSLALQLSTDPSSSSLLLVGREAMRPAG
PVSPPEEDPGRTKHRRKQKTPKKFTGEQPSISGTFGLKGLAKAEDKARVHRSKKQEGLGP
EDVRKKVPATPVIVSKEAPTPVTHSAPGGPEEQWQRAIHERGEAICPTCNVVTRKTLVGL
KKHMEVCQKLQDALKCQHCRKQFKSKAGLNYHTMAEHSAKPAAAEASEGGEQEERERLRK
VLKQMGRLRCPQEGCGAAFSSLMGYQYHQRRCGKPPCEVDSPSFPCAHCGKTYRSKAGHD
YHVRSEHSAPPPEEPMEKTPEAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDW
TKRRMKDDLVPETARLNYTRPGLPTLNPQLLEAWKNEVKANGHVNCPNDCCEAIYSSVSG
LKAHLASCSKGDHLVGKYRCLLCPKEFSSESGVKYHILKTHAENWFRTSADPPPKHRSQG
PLISRKEKRSLAGGKKRGRKPKERPPEEPMPKLLHRRDDWPLGGRDKGSRGSTGRKVGAS
KSP
Download sequence
Identical sequences ENSSTOP00000009923 ENSSTOP00000009923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]