SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010191 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010191
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 1.83e-64
Family TRADD, N-terminal domain 0.000000199
Further Details:      
 
Domain Number 2 Region: 217-304
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000801
Family DEATH domain, DD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010191   Gene: ENSSTOG00000011360   Transcript: ENSSTOT00000011356
Sequence length 308
Comment pep:novel scaffold:spetri2:JH393285.1:17628803:17630856:-1 gene:ENSSTOG00000011360 transcript:ENSSTOT00000011356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGPNGPEEWVGSAYLFLESLLDKVVLSDAYAHPQKKVAVFRALQTSLTESAESPDVLQ
ILKIHRSDPQLIVQLRFCGRQPCSRFLHVYREGTLRAKLQSCLAAALAQHSVPLQLELRA
GAERLDAWLTDEEHCLNCILAQKPDRLRDEELGELEDALCNLTCGLEGQGDNVDVDVDVS
LVPSPPEGKPPPLSGQTFLFQGRPVANRPLSLQDQQTFARSVGLKWRRVGRSLQRSCRAL
RDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGM
AGPDGGLA
Download sequence
Identical sequences ENSSTOP00000010191 ENSSTOP00000010191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]