SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010619 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010619
Domain Number 1 Region: 719-776
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.09e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 25-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000615
Family Somatomedin B domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000010619
Domain Number - Region: 61-134
Classification Level Classification E-value
Superfamily E set domains 0.000574
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010619   Gene: ENSSTOG00000011833   Transcript: ENSSTOT00000011840
Sequence length 817
Comment pep:novel scaffold:spetri2:JH393429.1:879411:887197:-1 gene:ENSSTOG00000011833 transcript:ENSSTOT00000011840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLPWVLLLLATVPSSGPRPTAGAQDSCSLRCGNQNGPCSCHPTCSGLGTCCLDFQNFCL
EVSPSSGSMMGGKDFVVQHLKWFSSTDGVICRFKESIQTLGHVDSLGQVHCISPLLYESG
RIPFNISMDNGRSFPYAGTWLAVHPYKVSETEKSQLVNETRWQYYGTPGTTGNLSLTWNT
SRLPTQAVTIELWGYEETGKPYSENWTAEWSYLYTLATNVPNSGFFTFTPKPASPDYQRW
KVGALRIVDSKNYPGKKDVLALWTNDHALAWHLGDNFREDSVAWARAQCLAWEALEDQLP
NFLKELPDCPCTLAQARADSGRYFTDYGCDIEHGSVCTYHPGAVHCVRSVQASPHYASGQ
QCCYTAAGTQLLTADSTSGSTPDRGHDWGSPPYRTPPRVPSMSHWLYDVISFYYCCLWAP
ECSRYMRRRPSSDCRNYRPPHLASVFGDPHFVTFDGTNLTFNGRGEYVLLEAVLTDLKVQ
ARAQPGMMTNGSQARGTGLTAVAVQEGNSDVVEVRLAQRSGVLEVLLNQEVLSFAEQSWM
DLKGLFLSVAAEDKVSIMLSSGAGLEVSIQGPFLSVAILLPDKFLTYTRGLLGTLNNDPT
DDFTLRSGRVLPLNASAQELFQFGADWAVHNTSSLFTYDSWFLINNFVYQPKHDPTFEPL
FPDKSTLSPSQAEEAAKLCGNDHFCKFDVAATGSLSVGNATLVAHQLHQQRMQSLQPVIS
CGWLAPPANGHKEGLRYLVGSTVHFHCNRGFSLAGAETSTCQADGTWSTPTPECQLGRSY
TVLLSIIFGGLAVVLLVSIIYVLLRRKGNMNMWSLQP
Download sequence
Identical sequences ENSSTOP00000010619 ENSSTOP00000010619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]