SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013125 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013125
Domain Number 1 Region: 3-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.98e-20
Family Ribosomal protein L24e 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013125   Gene: ENSSTOG00000014654   Transcript: ENSSTOT00000014652
Sequence length 156
Comment pep:novel scaffold:spetri2:JH393440.1:1753670:1758114:1 gene:ENSSTOG00000014654 transcript:ENSSTOT00000014652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKK
GQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQA
SKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Download sequence
Identical sequences A0A0H2UH99 A0A286X7X2 F1PGD7 F6TKN9 F6Y6W2 M3W052
ENSSTOP00000013125 ENSMMUP00000019735 ENSECAP00000021530 ENSECAP00000021530 ENSCAFP00000014113 ENSFCAP00000003066 9544.ENSMMUP00000019735 9796.ENSECAP00000021530 ENSMMUP00000019735 ENSCAFP00000014113 ENSSTOP00000013125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]