SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014670 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014670
Domain Number 1 Region: 864-1075
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-34
Family DBL homology domain (DH-domain) 0.0011
Further Details:      
 
Domain Number 2 Region: 1238-1424
Classification Level Classification E-value
Superfamily PH domain-like 1.84e-26
Family Pleckstrin-homology domain (PH domain) 0.00000564
Further Details:      
 
Domain Number 3 Region: 1064-1185
Classification Level Classification E-value
Superfamily PH domain-like 3.78e-25
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014670   Gene: ENSSTOG00000016385   Transcript: ENSSTOT00000016388
Sequence length 1428
Comment pep:novel scaffold:spetri2:JH393317.1:11326465:11432699:-1 gene:ENSSTOG00000016385 transcript:ENSSTOT00000016388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLFFLEIKKPPVAPKPKFVVANNKPSPPPVAPKPDIVIASGPQSTKKTKPAIAPKPKVLK
SSPVRDIGQSSSGTISVNLEEHKLELPESTDNFNCKNVEDQSSDYILPICSCRSECVHKL
GNREDSYVKQLVLEPLEMKENLQNSKIDESSLTVKTKSRWDSRGEKHKNQSGVVLKASIL
EGKLKDVLTQQMSPVSSLKKHRSTDNPERNGGCNSNRQFRIELADLSPSLSSFVKLPVHH
NCQVQLPRDEFQSPETCQDSSEKSNSHFHSSDQEALENGKRNTFISSDGVSKKTEVEDLG
PLEIHLVPCTPRFPTPKPRKTRPARLLRQKYIDTPSESTEEPENFNNSSSCLIEDSLKNN
KVSILHQDALCNQEQVDKVKPGNNSELNSNSNDDSQDLVNSEAMCQETSSSEKVAPSLDT
DSNLSSDGTSVDGASMALATDQGTSFIRCSTLSLSLPKQLKLTYNEHLPTACNLEVSIPQ
MQKESIVKEESSSKIVPRKPQRHSLPAAGVLKKAASEELVEKSSYPSNEEKNSEKVLERN
HLCASNHGMSSPFDMPKRTSEKPVWKLPHPILPFLGNPESLKSVTTSSHSEPPTALTKPR
AKSLSAVDMDRCTKPCKDSPKKTSLKKWLNMKLSISFMKSDFQKFWSKSSQLGETHTGSC
GEQKGTESDWHDLMVGEEKRSKPIKAYSADNYSLESQKKRKKSRGQTSTANGLRAESLDD
QMLSKESSCQVVCRSLTNSCAPEYENIRHYEEIPEYENLPFIMAVGKTRELEWQDSCSGE
ETDANVYEVEEPYEAPDGQWQLGPRHQRFRMAWKREFLESANISSEDVAASEQIVTSFPK
EDIGSKYPQPIKKKQDEDAGIKSKVHHIAKEIMSSEKVFVDVLKLLHIISFSCLGNERNA
SLSSCKDGNEARPLLLGIHFALMILHDISRSVHKEQRNNFIALWIYTLKIPIVFIKCWSF
ALYYYNYIGKFPSVWELLSRECRDNMVFTLDFSSFQMSPRCANLALKHYLLKPVQRIPQY
RLLLTDYLKNLLEDSGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHE
IVQPGRVFLKEGILKKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRK
PTQEAYQNELKIESVERSFILSASSATERDEWLEAISRSIEEYAKKRTTFCPSRSLEEAD
SENKDEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGL
DYLKNQPARVCEHCFQELQKLDRQHSPKVGSPGNHKSPSSALSSVLHSIPSGRKQKKIPA
ALKEVSANTEDSSMSGYLYRSKGNKKPWKHLWFVIKNKVLYTYAASEDVAALESQPLLGF
TVTQVKDENSESKVFQLLHKNMLFYVFKADDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences ENSSTOP00000014670 ENSSTOP00000014670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]