SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014912 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014912
Domain Number 1 Region: 313-592
Classification Level Classification E-value
Superfamily Kelch motif 1.06e-69
Family Kelch motif 0.0000458
Further Details:      
 
Domain Number 2 Region: 46-161
Classification Level Classification E-value
Superfamily POZ domain 3.53e-35
Family BTB/POZ domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014912   Gene: ENSSTOG00000022762   Transcript: ENSSTOT00000019768
Sequence length 602
Comment pep:novel scaffold:spetri2:JH393388.1:6120829:6145808:-1 gene:ENSSTOG00000022762 transcript:ENSSTOT00000019768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLILGRRLNREDLGVRDSPATKRKVFEMDPKSLTGHEFFDFSSGSSHAENILQIFNEFR
DSRLFTDVIICVEGKEFPCHRAVLSACSSYFRAMFCNDHRESREMLVEINGILAEAMECF
LQYVYTGKVKITTENVQYLFETSSLFQISVLRDACAKFLEEQLDPCNCLGIQRFADTHSL
KTLFTKCKTFALQTFEDVSQHEEFLELDKDELIDYICSDELVIGKEEMVFEAVMRWVYRA
VDLRRPLLHELLTHVRLPLLHPNYFVQTVEVDQLIQNSPECYQLLHEARRYHILGNEMMS
PRTRPRRSTGYSEVIVVVGGCERVGGFNLPYTECYDPVTGEWKSLAKLPEFTKSEYAVCA
LRNDILVSVKGGRINSRDVWIYNSQLNIWIRVASLNKGRWRHKMAVLLGKVYVVGGYDGQ
NRLSSVECYDSFSNRWTEVAPLKEAVSSPAVTSCVGKLFVIGGGPDDNTCSDKVQSYDPE
TNSWLLRAAIPIAKRCITAVSLNNLIYVAGGLTKTIYCYDPVEDYWMHVQNTFSRQENCG
MSVCNGKIYILGGRRENGEATDTILCYDPATSIITGVAAMPRPVSYHGCVTIHRYNEKCF
KL
Download sequence
Identical sequences G1T4M8
9986.ENSOCUP00000011244 ENSSTOP00000014912 ENSOCUP00000011244 ENSSTOP00000014912 ENSOCUP00000011244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]