SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016259 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000016259
Domain Number - Region: 148-187
Classification Level Classification E-value
Superfamily UBA-like 0.00102
Family CUE domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016259   Gene: ENSSTOG00000022008   Transcript: ENSSTOT00000021112
Sequence length 286
Comment pep:novel scaffold:spetri2:JH393410.1:3443766:3445538:1 gene:ENSSTOG00000022008 transcript:ENSSTOT00000021112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERIVSAALLEFVQTNLPEADLSGLDEVIFSYVLGVLEELGPSGPSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMKKLSGQLSDAKNKENLQPQSSCIQGQVPISPEPLQRPEKR
KEEARSPAAAGDTQDEAAGTEEELLPGVDVLLEVFPTCSMEQAQWVLTKARGDLEEAVQM
LVEGKEEGSPAWDGPSQDLPRRLRGPQKDELKSFILQKYMMVDSAEDQKIHRPMAPKEAP
KKLIRYIDNQVVSTKGERFKDMRNPEAEEMKATYINLKPARKYRFH
Download sequence
Identical sequences I3MVW4
XP_005333679.1.77405 XP_005333680.1.77405 ENSSTOP00000016259 ENSSTOP00000016259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]