SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016512 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016512
Domain Number 1 Region: 84-113
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000294
Family LIM domain 0.01
Further Details:      
 
Domain Number 2 Region: 48-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000677
Family LIM domain 0.0034
Further Details:      
 
Domain Number 3 Region: 20-48
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000952
Family LIM domain 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000016512
Domain Number - Region: 114-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000734
Family LIM domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016512   Gene: ENSSTOG00000027480   Transcript: ENSSTOT00000029933
Sequence length 155
Comment pep:novel scaffold:spetri2:JH393338.1:9712102:9747262:1 gene:ENSSTOG00000027480 transcript:ENSSTOT00000029933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEV
GSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQ
RFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Download sequence
Identical sequences ENSSTOP00000016512 ENSSTOP00000016512 ENSGGOP00000023380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]