SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016921 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016921
Domain Number 1 Region: 270-380
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000183
Family Second domain of FERM 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000016921
Domain Number - Region: 28-176
Classification Level Classification E-value
Superfamily ARM repeat 0.00173
Family MIF4G domain-like 0.069
Further Details:      
 
Domain Number - Region: 207-264
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00527
Family UBX domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016921   Gene: ENSSTOG00000021155   Transcript: ENSSTOT00000026229
Sequence length 483
Comment pep:novel scaffold:spetri2:JH393404.1:814493:828900:1 gene:ENSSTOG00000021155 transcript:ENSSTOT00000026229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEFALHYFRKPSTLLDQRGGSAQGNVITSLVQYTKSPIQESLIRLSDEDMSKQAVAGFQ
ALMQFMGDKSKPRGKEEMDLLYDLLKLCSKEDLRDEMYCQVIKQVTGHPQPEHCARGWSF
LSLLSGFFPPSTTLMPYVTKFLQDSGPSQELARTSQEHLQRTVKYGGRQQLPPMAEMKAF
LKGHAVRLLVVHLPGGVNYRTNGHMFTVAGEVLEELCGQMGIRDPQEVEEFALFLIKGEG
ELVRPLWPHEYLNRVMVHQDVSLHSRRLGWETPLHFNHPTYIKTHYGQVLRDYLQGKLMA
SAQAEHQLAQLAALQHLVRARKSPPSGQDLLAYIPKPLQWQVNMATIESLMGQELRQLQG
HSPQEAQISFIEATSQLPLFGYTVYVVLRVSKLVLPGPALLGLNRSHLILMDPSSQKLCC
SIALKDLQRLRLLSPLEEEGPPGLELNYGLADSPQTIWLELPQQAQELQNTIIFLLDDSI
SST
Download sequence
Identical sequences ENSSTOP00000016921 ENSSTOP00000016921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]