SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017098 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017098
Domain Number 1 Region: 633-808
Classification Level Classification E-value
Superfamily PH domain-like 7.93e-36
Family Phosphotyrosine-binding domain (PTB) 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000017098
Domain Number - Region: 601-640
Classification Level Classification E-value
Superfamily SH3-domain 0.00834
Family SH3-domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017098   Gene: ENSSTOG00000025549   Transcript: ENSSTOT00000026937
Sequence length 820
Comment pep:novel scaffold:spetri2:JH393439.1:202005:210983:-1 gene:ENSSTOG00000025549 transcript:ENSSTOT00000026937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADRAEMFSLSTFHSLSPPGCRPPQDISLEEFDDEDLSEITDDCGLGLSYDSDHCEKDSL
SLGRSEQPHPICSFQDDFQEFEMIDDNEEEEEEEEEEEEEEEEEEGDGECKEGGGPESEA
STQKPLIPSPSLEEPHKHRPTTLHFTSLGAQDSLNNNGGFAPAPPASWQETVLCSQAQEI
LGELPGPLPPTEEGLCEEQSLVCPGCDCEGNRPPEPRAPGGASPSSDPGIEADLRSRSSG
GHGGRRSSQELSSPGSDLEEASGVRLGRMISSISETELELSSDGGSSSSGRSSHLTNSIE
EASSPASEPEPEPLPEAPRRPAFLPVGPDDTNSEYESGSESEPDLSEEADSPWLLSNLVS
RMMSEGSSPIRCPGQCLSPAQRLPGEPLSPAGSAAEDSQGPDVAVGPGVELVDMETLCGP
PPPAPAAPLPGAAQPGPCLFLSNPTRDTITPLWAAPGRASRPGRAYSAACSEEEEEDAED
SVGPPGARSLRSAAPRDASLVYDAVKYTLVVDEHTQLELVSLRRCAGLGHDSEEDSSGEA
SEEEVGAALLGSDQAPGDASPDSPDLTFSKKFLNVFVNSTSRSSSTESFGLFSCLVNGEE
REQTHRAVFRFIPRHPDELELDVDDPVLVEAEEDDFWCRGFNMRTGERGVFPAFYAHAVP
GPAKDLLGSKRSPCWVERFDVQFLGSVEVPCHQGNGILCAAMQKIATARKLTVHLRPPAS
CDLEISLRGVKLSLSGGGPEFQRCSHFFQMKNISFCGCHPRNSCYFGFITKHPLLSRFAC
HVFVSQESMRPVAQSVGRAFLEYYQEHLAYACPTEDIYLE
Download sequence
Identical sequences I3MYA2
ENSSTOP00000017098 XP_005335040.1.77405 ENSSTOP00000017098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]