SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018004 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018004
Domain Number 1 Region: 391-576
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-29
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 766-939
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-17
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 3 Region: 248-286
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000017
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 27-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 5 Region: 155-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000445
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 70-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 202-235
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000942
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 302-339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 342-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 581-665
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000453
Family Fibronectin type III 0.006
Further Details:      
 
Domain Number 11 Region: 1-31
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000115
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 12 Region: 107-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000018004
Domain Number - Region: 672-761
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00451
Family Fibronectin type III 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018004   Gene: ENSSTOG00000003552   Transcript: ENSSTOT00000019704
Sequence length 1046
Comment pep:novel scaffold:spetri2:JH393352.1:6287377:6352539:1 gene:ENSSTOG00000003552 transcript:ENSSTOT00000019704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIRSSWVCDGDNDCRDWSDEANCTAIYHTCEASNFQCHNGHCIPQRWACDGDADCQDGS
DEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLHDCSDGSDEQHCEPLCTRFMDFVCKNRQQ
CLFHSMVCDGIIQCRDGSDEDATFAGCSQDPEFHKVCDEFGFQCQNGVCISLIWKCDGMD
DCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSEEKDCGDSHI
LPSPTPGPSTCLPNYFRCSNGACVMDTWVCDGYRDCADGSDEEACPSLANVTAVSTPTQL
GRCDRFEFECHQPKKCIPNWKRCDGHRDCQDGQDEDNCPTHSTLTCMSREFKCEDGEACI
VLSERCDGFLDCSDESDEAACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVY
TVYYRVVGESIWKTLETHSNKTNTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPE
GLPDAPRNLQLSLHREAEGVIVGHWTPPIHTHGLIREYIVEYSRSGSKMWASQRAASNST
EIKNLLVNVLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPPPDIHIDSYGENSLSFTLT
MDGDIKVNGYVVNLFWTFDAHKQEKKTLNFRGSILSHKVGNLTAHTSYEISAWAKTDLGD
SPLAFEHVVTRGVRPPAPSLKAKAINQTAVECSWTGPRNVVYGIFYATSFLDLYRNPKSL
TTSLHNMTVIVSQDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSA
VIKWESPYDSPDQDLFYAIAVKDLIRKTDRSYKVKSRNSTMEYTLNKLEPGGKYHVIVQL
GNMSKDSSIKITTVSLSAPDALKIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAM
NLTAYLGNTTDNFFKISNLKMGHNYTFTVQARCLFGSQICGEPAVLLYDELGSGGDTAAI
QATRSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFTAFANSHYSSRLGSAIFSS
GDDLGEDDEDAPMITGFSDDVPMVIA
Download sequence
Identical sequences ENSSTOP00000018004 ENSSTOP00000018004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]