SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018474 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018474
Domain Number 1 Region: 209-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-27
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 2 Region: 265-322
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 378-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 47-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 6 Region: 175-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000863
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018474   Gene: ENSSTOG00000028734   Transcript: ENSSTOT00000025816
Sequence length 438
Comment pep:novel scaffold:spetri2:JH393353.1:217189:222335:-1 gene:ENSSTOG00000028734 transcript:ENSSTOT00000025816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQANHVSQEPQALLESALPSSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVY
FIRKEWKRLEPAQRDLYREVMLENYGNVFSLDGESRTKNDQEISEDTGSHGVLLRRFQKD
ISQGLKFEETYEQEVSLKRQLGNSSGERLNRKIQDFGHVTVKEKLTTVGERKEKHNEFRN
SYTVNSNLISHQRLLMGDRPHKCDECNKSFNRTSDLIQHQRIHTGEKPYECTECGKAFSQ
SSHLIQHQRIHTGEKPYECNDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTL
THHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQ
RIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHT
GEKPLNVTGMQKFPQSYC
Download sequence
Identical sequences ENSSTOP00000018474 ENSSTOP00000018474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]