SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000018483 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000018483
Domain Number 1 Region: 55-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-293
Family Motor proteins 1.81e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.8e-22
Family Myosin rod fragments 0.00031
Further Details:      
 
Domain Number 3 Region: 956-1071
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.28e-21
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 4 Region: 1236-1351
Classification Level Classification E-value
Superfamily Myosin rod fragments 8.63e-18
Family Myosin rod fragments 0.0024
Further Details:      
 
Domain Number 5 Region: 1060-1151
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000222
Family Myosin rod fragments 0.0037
Further Details:      
 
Domain Number 6 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000959
Family Myosin rod fragments 0.0012
Further Details:      
 
Domain Number 7 Region: 1349-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000392
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number 8 Region: 1759-1860
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000518
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000018483
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0392
Family Myosin S1 fragment, N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000018483   Gene: ENSSTOG00000028086   Transcript: ENSSTOT00000025823
Sequence length 1960
Comment pep:novel scaffold:spetri2:JH393302.1:4415411:4466285:1 gene:ENSSTOG00000028086 transcript:ENSSTOT00000025823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEDEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRIAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKATLEKAKQTLESERGELANEVKALQQGKGDSEHRRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLGLSTKLKQVEDEKSSLKEQLEEEEEARRTLEKQIATLQAQVTDMKKKMEDGVGCL
ETAEEAKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLLGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELEDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRAEKKLKDVLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGTGDCSDEEVDGKADGAEAKPAE
Download sequence
Identical sequences I3N287
ENSSTOP00000018483 XP_005322354.1.77405 ENSSTOP00000018483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]