SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019920 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019920
Domain Number 1 Region: 494-603
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-25
Family Pleckstrin-homology domain (PH domain) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019920   Gene: ENSSTOG00000025149   Transcript: ENSSTOT00000027826
Sequence length 614
Comment pep:novel scaffold:spetri2:JH393352.1:3666631:3686786:1 gene:ENSSTOG00000025149 transcript:ENSSTOT00000027826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSKAELLRSVAQRKERLAVLDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVL
ERRYHSLTGGRPFPKTTSTLKEYVTLEQLKVLWGTSPTPPAPAPGLPPWASASRDLVPAT
CLPPALPSSFASITPSPKMEKLLLPAVDLEQWYQELMAGLGTGPTAASPRSSPPPLPAKA
SRQLQVYRSKMDGEATSPLPRTRSGPLPSSSGSSSSSSQLSVATLGRSPSPKSALLTQNG
TGSLPRNLAATLQDIETKRQLALQQKGQQVIEEQRRRLAELKQKAAAEAQCQWDALHGAV
PFQAGPSGYPPLMHHSILHHLPAGRERGDEGEHAYDTLSLESSDSMETSISTGGNSACSP
DNMSSASGLDAGKIEEMEKMLKEAHAEKSRLMESRVRLTWAKRQKAEREMELRRQALEEE
RRRREQVERRLQSESARRQQLVEKEVKMREKQFSQARPLTRYLPIRKEDFDLKTHIESSG
HGVDTCLHVVLSSKVCRGYLVKMGGKIKSWKKRWFVFDRLKRTLSYYVDKHETKLKGVIY
FQAIEEVYYDHLRSAAKKRFFHFTMVTESPNPALTFCVKTHDRLYYMVAPSAEAMRIWMD
VIVTGAEGYTQFMN
Download sequence
Identical sequences ENSSTOP00000019920 ENSSTOP00000019920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]