SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020298 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020298
Domain Number 1 Region: 350-632
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-46
Family Kelch motif 0.0051
Further Details:      
 
Domain Number 2 Region: 768-913
Classification Level Classification E-value
Superfamily C-type lectin-like 7.26e-24
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 3 Region: 112-219
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000115
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 4 Region: 1047-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000356
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020298
Domain Number - Region: 969-1003
Classification Level Classification E-value
Superfamily Plexin repeat 0.000575
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number - Region: 83-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00153
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020298   Gene: ENSSTOG00000024663   Transcript: ENSSTOT00000028631
Sequence length 1255
Comment pep:novel scaffold:spetri2:JH393295.1:15029998:15114228:1 gene:ENSSTOG00000024663 transcript:ENSSTOT00000028631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAAAAAAETMAAPAGRKGWRQRDPDVTWTGRLRSGLGLPRLLVVLPLLLLLLLLPLLLL
LLWPRKAGAAAATGSGSLASEAKKCDQPCVNRGRCDPGTGQCICPAGWVGEQCQHCGGRL
KLTGSSGFITDGPGYYKYKMKCTWLIEGQPNRKMRLRFNHFATECSWDYLYVYDGDSIYA
PLIAAFRNYLLNSHMVGGCVCQSAFAFTYIRMHYNSYYIYRAQFFIYLVVYIVYSHQFVS
SYMCSSSNWGDLSTRLAGHWAPTPGCPVCLSCGRQLGPSSNWDDVFTSLAGLCACSPGVG
GGSAPPPNNSVIFFSKTNKILKIKYDERKGKFSGNFLLFIISFLGCIEGKVIVIKYDLAS
REWLPLNHSVNNVIVRYGHSLALYQDNIYMYGGKIDSTGNVTNELRVFHIHNESWVLLTP
KAKEQYAVVGHSAHVVTLKSGRVVMLVIFGHCPLYGYISNVQEYDLERNTWSILHTQGAL
VQGGYGHSSAYDHKTKALYVHGGYKAFSAVKYRLADDLYRYDVDTQMWTILKDSRFFRYL
HTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRWSVLPRPNLHRDVNRFG
HSAVLHNSTMYVFGGFNSLLLSDILVFTLEQCEAHQGEAACVAAGPGVRCVWDTGLSQCI
SWELATEEQAEKLKSECFPQTTLDHDRCDQHTDCYNCTANTNDCHWCNDHCVPIHLSCME
DQISISTYENCLKDNPKYSCVKKTSCRSCDLDQKCQWDPQNQECISLPENICGVGWHLVG
NSCLKITTAKENYDNAKLYCRNHNAFLASLTTQKKVEFVLKQLQIMQPSQSMSKLTLTPW
VGLRKINMTHWFWEDMTPFTNSLLQWITSEPSDAGFCGVLSEPTVRGLKAATCINPLNGS
ICERPANHSAKQCRTPCALRTACGECTSSSSECMWCSNMKQCVDSNAYVASFPFGQCMEW
YTMSSCPPEDCSSYYTCSHCLEQPGCGWCTDPSNTGKGKCMEGSYKGPVKMPPQASAGTA
YPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISGF
YGDPTNGGKCQPCKCNGHASLCDTNTGRCFCATKGIKGDQCQLCEVENRYQGNPLKGTCY
YTLLIGYQFTFTLSQEENRYYTAINFVAIPKEQNRDLDMFINASKNFNLNITWAASFSDG
AQPEEQMPIVSKNNIKEYKDSFSNEKFDFQNHPNVTFFVYVSNFTWPVKIQVRYA
Download sequence
Identical sequences ENSSTOP00000020298 ENSSTOP00000020298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]