SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020339 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020339
Domain Number 1 Region: 49-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000131
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 2 Region: 274-367
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000145
Family I set domains 0.023
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020339
Domain Number - Region: 172-203
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0419
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020339   Gene: ENSSTOG00000012198   Transcript: ENSSTOT00000012200
Sequence length 413
Comment pep:novel scaffold:spetri2:JH393351.1:1263900:1265138:1 gene:ENSSTOG00000012198 transcript:ENSSTOT00000012200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAHTTVLLWAWASLQAFEIVEKENIFLKTPCPAFLMFDNAAYLADMSFELPCHCKPEE
VPAVVWYYQKHVGSSHTKVLTDFDGRVLTEAAQVRVGSDMLVRFSIRMFSLLVFRAQPED
SGLYFCGTRKGEYFYAYDVDIQSNEGMVATFKDMGQKPFADEYYGNLHVFTTFWEWTPCD
RCGVRGEQWRIGLCYLQSPDLSPRYLRTQSDVVSCGSQAVPKRLRTTVRDHMPELLVQSC
LVPCEKKNRFRESVLAIYNYVSKVGSKPWVPKVPIQFHQQRLGHGLIISCPGARPEHAVA
WDKDHQHLYRTQYLKGVNRSMRVFIDHGNQLHIRFTQLSDRGIYYCWRQGVQIAGFRLSV
TSRGHYPASLSDPETRAAVELTLISYLLITAIFVTVHLCRCCCYSFRFRPMFS
Download sequence
Identical sequences ENSSTOP00000020339 ENSSTOP00000020339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]