SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020720 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020720
Domain Number 1 Region: 145-400
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.54e-71
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 76-158
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.11e-31
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020720   Gene: ENSSTOG00000025965   Transcript: ENSSTOT00000027746
Sequence length 414
Comment pep:novel scaffold:spetri2:JH393293.1:6826519:6938995:-1 gene:ENSSTOG00000025965 transcript:ENSSTOT00000027746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQ
GGPGGPGGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRN
CPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSG
YISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD
QVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVE
KLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF
GKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Download sequence
Identical sequences A0A286XI75 F1SCJ6 G3TD61 I3N8M4
ENSLAFP00000012060 ENSSSCP00000002449 9615.ENSCAFP00000011928 9823.ENSSSCP00000002449 ENSSTOP00000020720 ENSSTOP00000020720 NP_001177181.1.46622 XP_003413951.1.64505 XP_003475314.1.53824 XP_004271709.1.21590 XP_004372716.1.4749 XP_004405835.1.74151 XP_004623321.1.9945 XP_004658213.1.11716 XP_004709914.1.18182 XP_004759858.1.14098 XP_004852764.1.39548 XP_005320154.1.77405 XP_006870754.1.41390 XP_007453026.1.90284 XP_008850565.1.79516 XP_015997319.1.101085 XP_019315691.1.44245 XP_019493404.1.44202 XP_020035556.1.5219 XP_021536187.1.83697 XP_849497.2.84170 ENSSSCP00000002449 ENSLAFP00000012060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]