SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020907 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020907
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-24
Family SH2 domain 0.0000532
Further Details:      
 
Domain Number 2 Region: 209-256
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000157
Family SOCS box-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020907   Gene: ENSSTOG00000024583   Transcript: ENSSTOT00000024159
Sequence length 257
Comment pep:novel scaffold:spetri2:JH393339.1:2117771:2124528:-1 gene:ENSSTOG00000024583 transcript:ENSSTOT00000024159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLCVQGSCPLLAVEQIGQRPLWAQSLELPEPAMQPLPAGAFLEEVAEETPVQPESEPKV
LDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSV
KTTRGPTNVRIEYADSSFRLDSNCLSRPRILAFPDVVSLVQHYVASCSADTRSDSPDPVP
TPALPVPKEDAPSDPALPVPVATAVHLKLVQPFVRRSSARSLQHLCRLVINRLVADVDCL
PLPRRMADYLRQYPFQL
Download sequence
Identical sequences I3N961
ENSSTOP00000020907 ENSSTOP00000020907 XP_005327023.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]