SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021965 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021965
Domain Number 1 Region: 374-494
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-27
Family SH2 domain 0.00043
Further Details:      
 
Domain Number 2 Region: 497-535
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000109
Family SOCS box-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021965   Gene: ENSSTOG00000024501   Transcript: ENSSTOT00000028012
Sequence length 535
Comment pep:novel scaffold:spetri2:JH393774.1:174309:175916:1 gene:ENSSTOG00000024501 transcript:ENSSTOT00000028012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKISLKTFRKSFNLNKSKEDTDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINSED
EKGGKSRSKSESLMGTLKRRLSVKQKPKGKGSTPPGGLAEEDTFSSSSAPVVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFHDLQA
ETVCQEQNGSLKRSDSPHGDLHLHLEEHVPVVIGLVPQDYIQYTVPLDEGMCPLEGSRSY
CLDTSSPMEVSAVPPQVGGSSFAEDENQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
RASHDEVPPLSPLLPPMQTNQIQRNFSGLTGTDAHVAESMRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
Download sequence
Identical sequences ENSSTOP00000021965 XP_005342176.1.77405 ENSSTOP00000021965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]