SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022521 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022521
Domain Number 1 Region: 222-472
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.04e-90
Family Eukaryotic proteases 0.0000504
Further Details:      
 
Domain Number 2 Region: 128-233
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-18
Family Hepsin, N-terminal domain 0.042
Further Details:      
 
Domain Number 3 Region: 93-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000602
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022521   Gene: ENSSTOG00000024702   Transcript: ENSSTOT00000021367
Sequence length 476
Comment pep:novel scaffold:spetri2:JH393310.1:1480688:1501735:1 gene:ENSSTOG00000024702 transcript:ENSSTOT00000021367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPEMDVEVEVEPSLRGPEIVTMGENDPPATEAPFSFRSLFGLDDLKISPVVPDADAVA
AQILSLLPLKFVPIIVVGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELTARCDGVSD
CRDGEDEFRCVRVSGQNAVLQVFTAASWRTMCSDDWKGHYANVACAQLGFPSYVSSDSLR
VDTLEEQFRGHFVSINHLLPDDKVTMLHHSVYVREGCASGHAVTLKCTVCGLRTGYSPRI
VGGNVSSLAQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYLPKSWTIQVGLVSL
LDSPEPSHLVEKIIYHSKYKPKRLGHDIALMKLAGPLTFSEMIQPVCLPNSEENFPDGKV
CWTSGWGATEDGGDASPVLNHAAVPLISNKLCNHRDVYGGIISPSMLCAGYLKGGVDSCQ
GDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQMERDLQT
Download sequence
Identical sequences XP_005323519.1.77405 ENSSTOP00000022521 ENSSTOP00000022521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]