SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023051 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023051
Domain Number 1 Region: 551-807
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.71e-87
Family Eukaryotic proteases 0.0000762
Further Details:      
 
Domain Number 2 Region: 331-435
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000222
Family Spermadhesin, CUB domain 0.0041
Further Details:      
 
Domain Number 3 Region: 69-159
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000157
Family SEA domain 0.0049
Further Details:      
 
Domain Number 4 Region: 516-555
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 480-511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000013
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 230-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000034
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 7 Region: 445-477
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000497
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023051   Gene: ENSSTOG00000023875   Transcript: ENSSTOT00000020760
Sequence length 808
Comment pep:novel scaffold:spetri2:JH393302.1:3819347:3848938:1 gene:ENSSTOG00000023875 transcript:ENSSTOT00000020760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVAEAPQAAGGQGDGGDGEDAEPEGTFQGPEDSKRKVRDSLRLAPLWLALVALASVGVM
LWYFLGYRAEVTVSQVFSGSFRVLNRHFSQDLARRESSVFRSETARAQRMLAELITSTQL
GAYYNASSVYSFGEGPLTCFFWFILQVPERRRPSLSPEVVRALLVEELLSNGSALAPYRA
EYEVDPEGLVILEASVKDVGALNATLGCYRYSYVGRGQALRLKGPDHLASSCLWHLQGPQ
DLMLKLRLEWTLPECRDRLAVYDAPGPLEKRLITSGSGQSPPPPRASVSPSVTKQPAERG
PLAHDSFSLPVPPLLLPTQACQVNVTLEGRLDTQGVLSTPYFPSYYSPSTHCSWHITVPS
LDYGLALWFDAYALRRQKYDLPCTQGQWTIQNRRLCGLRTLQPYAERIPVVTTAGITINF
TSQISLTGPGVRVHYGLYNQSDPCPGEFLCSVNGLCVPACDGIKDCPTGLDERNCVCRAT
FQCQEDSTCVSLSRVCDRQPDCLNGSDEEQCQEGVPCGTFTFRCEDGSCVKKPNPQCDGR
PDCRDGSDERHCDCGLQGPSSRIVGGAVSSEGEWPWQASLQVRGRHICGGALIADRWVVT
AAHCFQEDSMASPALWTVFLGKVRQNSRWPGEVSFKVSRLVLHPYHEEDSHDYDVALLQL
DHPVVRSTTVRPVCLPARSHFFEPGLHCWITGWGALREGGEQGPAVGGARGPTSNVLQKV
DVQLVPQDLCGEAYHYQVTPRMLCAGYRKGQKDACQGDSGGPLVCKELSGRWFLAGLVSW
GLGCGRPNYFGVYTRITGVIGWIQQALA
Download sequence
Identical sequences ENSSTOP00000023051 ENSSTOP00000023051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]