SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023212 from Ictidomys tridecemlineatus 69_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023212
Domain Number 1 Region: 336-461
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000108
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023212   Gene: ENSSTOG00000025656   Transcript: ENSSTOT00000022039
Sequence length 463
Comment pep:novel scaffold:spetri2:JH393439.1:4496720:4511616:-1 gene:ENSSTOG00000025656 transcript:ENSSTOT00000022039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGSESDSGGAFKG
FKGLVVPSGGGGFSGFGSGPGGKPLEGLSNGNSTSAPPFTGARAAAEPKATFGSFAANGP
TALVDKKISDPKTNGSSPQPSSSSLASSTACAGSTYHKQLAALNCSVRDWIVKHVNTNPL
CDLTPIFKDYEKYLATIEQQHDNSGSGNSESGMSQMSVDTQTPSLFGSAKLSQESTFLFH
GNKTEDTSEKKMEVVSEKKTDIAPEAASVSFNFGKKIDSSVLGSLSSGPSAGFSFSPGNS
SLFSKDITQSKPVSSPLEGQAEGGSNECKGEDEEESDEPPKVVVTEVKEEDAFYSTKKKL
IMTEPAGCASGSIGQGHQRPPGTLSRSVLVPVSFNAGNILLNVLIPPNMPCSRTGKNNVL
IVCIPNPPLDEKSATVPATMLIRVKTSEDADELHRILLEKKGA
Download sequence
Identical sequences ENSSTOP00000023212 ENSSTOP00000023212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]