SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|218245662|ref|YP_002371033.1| from Cyanothece sp. PCC 8801

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|218245662|ref|YP_002371033.1|
Domain Number 1 Region: 430-530
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.54e-29
Family Flavin-binding PAS domain 0.013
Further Details:      
 
Domain Number 2 Region: 358-409
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000000085
Family HAMP domain 0.0033
Further Details:      
 
Domain Number 3 Region: 610-815
Classification Level Classification E-value
Superfamily PP2C-like 0.0000144
Family PP2C-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|218245662|ref|YP_002371033.1|
Sequence length 817
Comment PAS/PAC sensor protein [Cyanothece sp. PCC 8801]
Sequence
MNHWRILLTKKWANLSLRAKIILAFFSLMIVSTTTVTVFSYRVLRIELTAQVGKDLQKQA
TKLAQQVSNLLINQVDQVTLISLSNVFQNELNLINSRYPKNQNTIQQEIQKNSQIWHQSK
KSNRLLGNYLNNPISRELREYQKHFPNNYQIFVTDKYGAIAGTTNLNLEYNQGEKQWWQQ
TWNNGRGAVYIEEPQYNQENLLLLVNIAVPIYKRSNSQASEVIGIIHTSYKISHALLPLL
QNINSGKTGHAYLFVSPKKYFSDYKFVNETNQELTKFISSLASYKEIKYQGEKRFFSKAS
VQPKNQEFSLLNNLPWLIIIYQDSSEILHPLIIARQTIMMAALGTLLVAGILASFIERLI
STPIRVLTKITQRIASGDLDYEIDLEQKDEIGLLAANFNIMVESLKSYFSKLRTSLKELS
DMKFALDQSVLVTVMEPNGRITYVNDKFCEISQYSRQELIGNNYRFLKSRYHTPEFYQSI
WDTLNQGNIWRGEIKNQTKDGSYYWVDSTMVPFLDENNKPFQYLAIRYDITARKDFEEAL
SQKVKERTDQLAQANQEIIQLNHQLQGENLRMSAQLNVARQLQQMVLPKPEELAAIKGLE
LAGFMEPADEVGGDYYDVLATDDVVTISIGDVTGHGLESGILMIMTQTVVRTLKEIREHD
PVKFLDTLNRTLYRNIERMNSDRHLTLAVLNYSHRRVSLSGQHEEVIFVRAGGELQRIDT
MNLGFPIGLDQNITDFIDQISLELQTGDGLVLYTDGITEAKDINKNHYGIERLCQVIQQN
WEKSAQQIQELVIQDLHEHIGQQKIFDDITLFVLKQK
Download sequence
Identical sequences B7JYK7
gi|218245662|ref|YP_002371033.1| 395962.Cyan8802_0823 41431.PCC8801_0795 WP_012594153.1.62203 WP_012594153.1.93053 gi|257058708|ref|YP_003136596.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]