SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288380|ref|YP_002223648.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288380|ref|YP_002223648.1|
Domain Number 1 Region: 43-347
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 3.4e-80
Family Variable surface antigen VlsE 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|203288380|ref|YP_002223648.1|
Sequence length 363
Comment vlp protein, beta subfamily [Borrelia recurrentis A1]
Sequence
MKRGIKGEMINRVMIIMVLVMVMMGCNSGGGIKEGEGESSQSKFLKSIIGLRNEFLNVFT
SFGDMVGGILGFNAVKSDDKRSKVGEHFKTIGDGLKSTKDKLDELSKQIVSTSNADIKGV
EAVIQGTSEVIAKLITSITELAGITKEGNVDIGDAGTAGSAAAVAADKASVEAIIKGVKE
IVETAEKSGVKIEKGNAGNSVANGNGPKAVVHNVQATAGDATKLAGEVAKADPWAMIDKI
KNAKTKNNVAPAANDDAGQLATATGANDNGSASTNADLAASVALKAMTKGGKFTQPAANE
DGAIKAAAASAVNKVLGILDMIIRKAVNLELDKVKEAVKGIRYSETSGSNATEAGTIQTS
TVK
Download sequence
Identical sequences B5RS36 Q9S3L9
gi|203288380|ref|YP_002223648.1|NC_011252 412418.BRE_6020 WP_012539573.1.6979 gi|203288380|ref|YP_002223648.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]