SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288453|ref|YP_002223815.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288453|ref|YP_002223815.1|
Domain Number 1 Region: 21-322
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 3.01e-81
Family Variable surface antigen VlsE 0.0000084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|203288453|ref|YP_002223815.1|
Sequence length 330
Comment vlp protein, delta subfamily [Borrelia recurrentis A1]
Sequence
MMMMVVMGCNSGGVKDPEKVFLSEMVNLGKGFLEVFVSFGDMITGTLGIKAETKKSEIGG
YFSKIAETMKEVREKLEKILEENGKYEKVREKVGEFIGKISKIEEGAKEASKGANGDIIG
NAKKGEDAVAASKDSVVSLVKGIKAIVEIVLGEKEGNAGNNIITEDKKDIGKLFGKKDGD
RAQEAEAAKVSTSIGAVSGADILKAIAKSKENPVTDSANGIEKATDAAEIAVVPSVDDKK
EIKEDTAKKDAIIAAGIALRGMAKEGKFAAKKDEDKSAHAVNGAVSSAVNKVLSTLVIAI
RNTVDKGLKEINEVLGEIKQGEGVEAKVSK
Download sequence
Identical sequences B5RS77
gi|203288424|ref|YP_002223775.1|NC_011258 gi|203288453|ref|YP_002223815.1|NC_011260 412418.BRE_2036 412418.BRE_3011 WP_012539695.1.6979 gi|203288424|ref|YP_002223775.1| gi|203288453|ref|YP_002223815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]