SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288454|ref|YP_002223816.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288454|ref|YP_002223816.1|
Domain Number 1 Region: 22-325
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.22e-65
Family Variable surface antigen VlsE 0.0000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|203288454|ref|YP_002223816.1|
Sequence length 341
Comment vlp protein, gamma subfamily [Borrelia recurrentis A1]
Sequence
MIMMVMMGCNSGVLEAEQGKNKFLQSLVNVSNEFLNVFTSFWEMVGSVLGLNVNSKKSDV
GKYFRTVQETVQGIKDGLNKIVNEMKEEKNPNAEATESAVKTLVESKLDKIIGGAKEASE
AIGDASDPIGNVSDQNAGAVGIEVDKLVKGLKSIVDIVLKEGKNDAGDDKKASDGSTSRT
SGNAGDGEAGKLFASANAGTAENAKKSAADAAKAVGAVTCADILQSMIEDNGEVVKLASS
NAAVAAVNANKKDGVIAGGIALRAMAKDGKFAGSSDAASVDAKKTVKGAAVSALIKALDT
LTVAIRKTVDLGLKNVKEAMKINANATSVLPDKDVSDAKNQ
Download sequence
Identical sequences B5RSA6
gi|203288454|ref|YP_002223816.1| 412418.BRE_2037 gi|203288454|ref|YP_002223816.1|NC_011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]