SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|203288461|ref|YP_002223823.1| from Borrelia recurrentis A1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|203288461|ref|YP_002223823.1|
Domain Number 1 Region: 59-356
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 2.88e-83
Family Variable surface antigen VlsE 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|203288461|ref|YP_002223823.1|
Sequence length 364
Comment vlp protein, delta subfamily [Borrelia recurrentis A1]
Sequence
MKEKKGKGNIEESISEYREKGREKRSKRGLKGIMVLVMVMMGCNSGGVSGGVKDPEKVFL
SEMVNLGKGFLDVFVSFGDMITGTLGIKADTKKSDIGKYFTDIEKTMISVKEKLQTEVAK
NGNYVKIKEVVDQFITGTLDKIAEGAKKASSGAAGGAVLGSSVKNEDAAPGEVASVNALI
EGIKTIVAVVLKNEGNADANKTTDDDKKDIGKLFSKASDNGSEAEAAKANASIGAVSGVD
ILQAIAKSDVVSAAGKDIDQAKDVAEIATAKNDSGTKETKQKDAVISGGIALRSMAKGGK
FATKNEDKAVPAINGVAASAVGKTLSALIIAIRNTVDSELKKINEVLATVKQEDKSSEAT
ASVQ
Download sequence
Identical sequences B5RS85
gi|203288432|ref|YP_002223783.1| gi|203288461|ref|YP_002223823.1| 412418.BRE_2045 412418.BRE_3020 WP_012539703.1.6979 gi|203288432|ref|YP_002223783.1|NC_011258 gi|203288461|ref|YP_002223823.1|NC_011260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]