SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320159487|ref|YP_004172711.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320159487|ref|YP_004172711.1|
Domain Number 1 Region: 1140-1430
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.5e-56
Family Complement components 0.0007
Further Details:      
 
Domain Number 2 Region: 1520-1641
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 0.00000000000068
Family Alpha-macroglobulin receptor domain 0.0038
Further Details:      
 
Weak hits

Sequence:  gi|320159487|ref|YP_004172711.1|
Domain Number - Region: 53-106
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0157
Family Invasin/intimin cell-adhesion fragments 0.0091
Further Details:      
 
Domain Number - Region: 143-233
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.0439
Family Invasin/intimin cell-adhesion fragments 0.0087
Further Details:      
 
Domain Number - Region: 989-1069
Classification Level Classification E-value
Superfamily E set domains 0.0476
Family SVA-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320159487|ref|YP_004172711.1|
Sequence length 1653
Comment hypothetical protein ANT_00770 [Anaerolinea thermophila UNI-1]
Sequence
MSRKTLVWLILTALILVGAVVLVERVVHYASLPSNLPPQEVVVVGQNRFIPGTQAALRLQ
VRDPFKGNPIPDAEVSLALRPKAGGNALTLYTGRSDANGMVEASFVVPMVDAPEQTLLVT
SKSPLGTEQLEQPVHVAREYRVLLSSDKPLYQPGQVIHLRALALDAFDLRPAAGRDITLT
IADGKGNKVFRKTLTTSAYGAAWTDFQLADEVNTGEYKITAQMGNTSSEKTVRVERYVLP
KFKVEMRTERTYYQPGQHVNGTLTANYFFGKPVAGGEVTLEGYTFDVQRNTVFTLEGTTD
EQGQYTFAFDLPVFMTGSELEGGMGRFYLQATVTDGARHAETANLSLPVSANGLVVDIVP
EGGYVRAGLENIFYLFTRYPDGTPAEATVQVTFTDSNTTFTVQTDAYGLGEVRVIPPQPY
VYITLQAQDRRGASAYREVSFEGEWTGESIILRPDKPVYRVGETMNLTLFSTQAQGTVYL
DIVRGGQTLSTRSVPLQGGRAEVAVDLSPEMYGTLELHAYKILPSGTITRDTRLVVVDPA
NDLSLAVQPGQDTYRPGEDAQLDVQVSGADGAGVAAALGIAIVDESVFALAEQDPGFARL
YFLLESEILTPRYDLHGYELPDLAYSQRFEQTSPTLRQDVERAARASLAEAVRAGGKSAF
SLAASSRPQSLNRARQMQVSFFNRLSGVFFPVFLLTAAGAVFGVVCALARQKRFWRSFFT
ALGILLGLILLILLIPWGNYSWDRSIGGRLTGFLQTFFEKMDALIVLFPLVGLLGISGLA
GTAIRRRDWTLGGTVLLLVLAFVSLVLFLIAGRFGNRFPSSGGLISLLIFYLLVMLSGWV
RTAGFLWERAFTPAFFGAALAIFLTLGWTPMLMMMGAASAPAPMAEDFGVPERRLVQGAV
PMAPQPTLAPGMVMEKGVESGGESQQPAQQEPRLRQYFPETMIWIPDAVTDENGFLRLNF
PVADSITTWRITALASSADGRLGSVDAPLRVFQDFFIDLDLPLALTVGDEIAVPVGVYNY
LPEPQTVRLVLEQAEWFDLLDEPEKSMTIGANEVSVVYFRIRAKAFGAQPFKVTAYGSRL
SDAILKSVQVYPDGKPIRLSASDRLEAGKPFQQSFFFPPEAIPGTQKVLVKVYPGVFSQV
VEGLESLLRMPFGCFEQTSSITYPNVLALDYLRTSGKSAPEVEMKAEEYINLGYQRLTTF
EVAGGGFSLFGNPPADRMLTAYGLQEFADMARVHPVDEALVRRAADWLMSQQASDGSWEN
DRGLVHENTWQSLGNDRLPVTAYVVWSLIDAGFVDESATQRGIIYLHGHLNEAKDPYVLG
LVANALVAADRAHGADIGTDANAALGELALQAQRNGSQVFWQSSVATFTGAEGRTGSIET
TALAALAMLRAQVYPDLTNGALAYLIAQKDSFGTWHSTQATVLSLKALLEGIRMGGEKMD
ARVTLTLNGGQTRTLQVTPDNFDVVQMVTFDDVPLGRENVVEMTMEGQGNLMAQVVGSYY
LPWSQMSRYPDLFPMDEGLDLRVTYDRTELSVADTVTVQVAATLKQEGARAEAVMLDLGI
PPGFSVMTEDLDALVTRYSDVLPAETRLERYELTGRQVLIYLTGMKGGEPFTFTYRLRAR
FPLRAQAPSALAYDYYNPQQQGELPPQLLVVNP
Download sequence
Identical sequences E8MYG6
WP_013558509.1.30606 gi|320159487|ref|YP_004172711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]