SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320160079|ref|YP_004173303.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320160079|ref|YP_004173303.1|
Domain Number 1 Region: 5-125
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 3.79e-34
Family Thiamin pyrophosphokinase, catalytic domain 0.0008
Further Details:      
 
Domain Number 2 Region: 150-211
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000628
Family Thiamin pyrophosphokinase, substrate-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320160079|ref|YP_004173303.1|
Sequence length 215
Comment thiamine pyrophosphokinase [Anaerolinea thermophila UNI-1]
Sequence
MTSQRALIFVSGASCNEEALRHFRQPEDFIIAADGGAQHCLRLGWRPHVVIGDFDSLSAE
ILNHLEREGVLLLRYPPEKDETDLELALQYAVQRGFEVIRILCGLGGRVDQTLANLFLLG
LPMLSDRDVRLEDGEVEAFLIRSEAVLEGAPGETVSLIPLSGAAQGIWTEGLRYSLHGET
LYPEHSRGVSNEMISARARVRLSHGMLLCIHFHSV
Download sequence
Identical sequences E8N1U8
gi|320160079|ref|YP_004173303.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]