SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320161276|ref|YP_004174500.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320161276|ref|YP_004174500.1|
Domain Number 1 Region: 26-353
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.35e-45
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320161276|ref|YP_004174500.1|
Sequence length 356
Comment hypothetical protein ANT_18740 [Anaerolinea thermophila UNI-1]
Sequence
MTRFVYVGTYTQTEPSKPHRQEGIFVYVMNPVTGKLTFSSSTSGLNPSFLAFHPRKHVLY
AVNELEEGMVSAFAIHPQTGALNLLNSQPTQGAHPCYVSVDRQGEWVMCANYTGGSISLH
PVLSDGSLGEISDWRQHQGVLGPNHARQETPHAHSIDFDPSGNYLLAADLGLDRIFIYRL
ERTQGKFLIHGEISLPPGAGPRHFTFTSNGRCLFVANELGSSVSILDWDLEKGKAEMVET
VSTLPPDFSGENIVADIHLSQDETFLYVSNRGHDSLAIFRVWGNRVPKLLPVMYASIQGS
WPRNFSIDPTGRFILVANQYSDNVVLFHRDRETGEIQPAGFSVEVNSPVCIKFYDL
Download sequence
Identical sequences E8N636
gi|320161276|ref|YP_004174500.1| WP_013560277.1.30606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]