SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320162076|ref|YP_004175301.1| from Anaerolinea thermophila UNI-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320162076|ref|YP_004175301.1|
Domain Number 1 Region: 834-1025
Classification Level Classification E-value
Superfamily TPR-like 1.93e-19
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 
Domain Number 2 Region: 150-278
Classification Level Classification E-value
Superfamily TPR-like 6.32e-19
Family BTAD-like 0.043
Further Details:      
 
Domain Number 3 Region: 999-1184
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000178
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number 4 Region: 293-367,419-584
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000519
Family RecA protein-like (ATPase-domain) 0.08
Further Details:      
 
Weak hits

Sequence:  gi|320162076|ref|YP_004175301.1|
Domain Number - Region: 688-825
Classification Level Classification E-value
Superfamily TPR-like 0.00247
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 
Domain Number - Region: 17-88
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.034
Family PhoB-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320162076|ref|YP_004175301.1|
Sequence length 1210
Comment hypothetical protein ANT_26750 [Anaerolinea thermophila UNI-1]
Sequence
MVGQHNPNVGGEPLKPLRIYLLGPPRVEILEGFAVIPRRQARALLYRLAAGVEPIPRERL
CFLFWPDEAEATARRYLSHLLTHLQRALIMPDCFVFNGDQIGLNFQQVWSDVVEFEDLCA
YLREPDTQYALQSYGTTGFLRDPAALRLRISLYHGSFLEGFSLPGAAEFEEWSTQKRYAL
ERLYLSAVEMLMEDFAEKGELELAIQYAQRYLDTDPLVEDVHRRLIELYAISGNRNAALR
QFEICARILEQELGVSPLPETRLIYQDVLERRIFLKRVIKPKWEPISGANVPLIGRAQAM
TWLEEAVQDALAGNEKVILISGEAGMGKSRLLQEFIARLSSNIAVIAGGAHVEACTLPYY
PIIQALRSLCHPAEEGAPAPLLRWLPPTLDHIWLVEASRVLPELRTLYPNLPLPLPAASE
EARSRLFDALVQIVIGLSTSPLFLRSFSSLLLCLEDLHWADSATLEWLVHFGRQIRGSHL
VVLGTYRSEEVDALVDLRQGLKSAQVLTELQLQGLDTSSILLLLSFFRGGTLDRQEEFAE
QLYASTGGNPFFLLEVLKSMLEKEETMEVCTGEKYIPLPDTVREVIQARIRRLTPVGRQV
LEAGAVIGPVFSFDFLRGVAGRREMEVVNGLDELVARQLLMESGVEYRFPHELVARVVEE
NLSPVRRQILHRRAGWTLARLNPAAVTALARHFDLGGEPRQALSYYEKAVQQAESLFAWK
EAEEHQNRMLVLLERLDPHQNQPDAIMQRGLIWLNRAYHDYLKGKIEDRDKDLEVVKTLA
EKLQQKTLYLQFLLQQVRYLNLGGHYKKAITLAEEGMQGIPGEELTSLSRFTVALLYVEI
AFAHYLLGQPRQGFSALRSAQVAAGESRNPEIQGPIKHHLGYMHLHRGEYLQALTHQQEA
LRCHQTARDFNGIAWAELDLGFLYLKLGQFLEAKNHLEASLRLAQRISARPAEIYARTYT
GYLKLYQGLYMPALECFRETIQLHQTVHQEHGVVAAEIGLGMALYHLGMDSEAGIRFQHA
VERAREVSHRRRLVEALVGWGLIELDEFHLQQAAQILDEAVHLARLSECGENLAAGLAAL
AQAQRRLGDSSAALKTAIEALTNAQRLALPVCEMWAQMEIGLSCLAAGENERALEHSSRA
VSLLPQAYEGWIPTEEVYFSHAKILSAMGSPAEAHYFQQQARILIEKKSQHISDPSQKER
YLLQKLPFLS
Download sequence
Identical sequences E8N0F2
gi|320162076|ref|YP_004175301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]