SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311068275|ref|YP_003973198.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311068275|ref|YP_003973198.1|
Domain Number 1 Region: 39-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.05e-16
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311068275|ref|YP_003973198.1|
Sequence length 185
Comment hypothetical protein BATR1942_06565 [Bacillus atrophaeus 1942]
Sequence
MTNFVHKTVNGLKSLLDEKGAIKLFCSEGDTMECLVTFSPDKATLNEIQNFEAKHQITLP
EDYQKFITLHNGAKIFEILSDGENIGGGLQLFSLEEIEEELKYEDLFEGINGIPIGYLLE
ECHLMIDKDKINQGDPNYLYIFESGLEYNPLNLNFEIFLDRYILANGEPFWDWRYYTAEN
YYRTR
Download sequence
Identical sequences A0A0H3E1D2
WP_003328797.1.100936 WP_003328797.1.15971 WP_003328797.1.39473 WP_003328797.1.62747 WP_003328797.1.7305 WP_003328797.1.79721 WP_003328797.1.99425 gi|311068275|ref|YP_003973198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]