SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311068278|ref|YP_003973201.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311068278|ref|YP_003973201.1|
Domain Number 1 Region: 27-82,122-172
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-17
Family SMI1/KNR4-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|311068278|ref|YP_003973201.1|
Sequence length 176
Comment hypothetical protein BATR1942_06580 [Bacillus atrophaeus 1942]
Sequence
MKTGTIKTVKKVFNSFSIQMGEYNESFNNIKQKLKEFSIDVKTDPSINTNEKLKEIEMNI
GKQLPCDYKDFLKEYGGCDLESKKTTDEVEYDVCYKPFEKDPWMGKDNDTQLLEGFYGLA
NDHNSLQIAIDTYSDRFSKNIIPIASSAGGNEICMDLVNEKILFWDHELSHLGQFV
Download sequence
Identical sequences A0A0H3DZ43
gi|311068278|ref|YP_003973201.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]