SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311068567|ref|YP_003973490.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311068567|ref|YP_003973490.1|
Domain Number 1 Region: 36-164
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.53e-21
Family SMI1/KNR4-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311068567|ref|YP_003973490.1|
Sequence length 177
Comment hypothetical protein BATR1942_08120 [Bacillus atrophaeus 1942]
Sequence
MEEGKLVHMTLGGIKKAVSKYGTFPMFHHGGHVMEDATFHFRDPANPQEVTNLEKKLGVS
VPNDYKEFLFKHNGMEMFNGVELLSTEGIIEYNEVQDFPKEYVLIGYHYDGRYVIDTNKS
RNGLGYMLYLDSIDDIEDAVNLDSNFEIWFDMLVSSNGTKYWEVSPNIQEYYKLVSE
Download sequence
Identical sequences A0A080ULU1 A0A0H3E420
WP_003325843.1.100936 WP_003325843.1.15971 WP_003325843.1.39473 WP_003325843.1.62747 WP_003325843.1.7305 WP_003325843.1.79721 WP_003325843.1.99425 gi|311068567|ref|YP_003973490.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]