SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|311069077|ref|YP_003974000.1| from Bacillus atrophaeus 1942

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311069077|ref|YP_003974000.1|
Domain Number 1 Region: 223-362
Classification Level Classification E-value
Superfamily CBS-domain pair 4.04e-27
Family CBS-domain pair 0.0026
Further Details:      
 
Domain Number 2 Region: 373-450
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.0000000000000354
Family CorC/HlyC domain-like 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|311069077|ref|YP_003974000.1|
Domain Number - Region: 187-213
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0294
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311069077|ref|YP_003974000.1|
Sequence length 452
Comment membrane associated protein [Bacillus atrophaeus 1942]
Sequence
MLEDDRKREVYAFLSEGRPLEYTKLIAVAVLIMVTAFFVAIEFSIVKVRRSRIDQYVAKE
IKGAKAAKHVITHLDEYLSACQLGITVTALGLGWLGEPTVQTLLHPLFLKLGLHESLTHF
LSLVIAFLLVTYLNVVIGELAPKSFAIQKAESITLMFAKPMIWFYKIMFPFIWVLNQSAR
LITGMFGLKPASETELAYTEEELRVLLAESYKSGEIKKSELKYMNNIFTFDKRMAKEIMV
PRNEMVSLPIDDESVESLQEIIKQTKYTRYPVVKEDKDHVIGVMNIKEVLFSLLSERFSF
TKEQLDPFIQPVIHVIETIPIYQLLIKMQKERTHMAILIDEYGGTSGLVTVEDIVEEIVG
EIRDEFDADEIPHIRELDKNHYMLNAKVLVSQVNDLLGTDLSDEEVDTIGGWFLTQDIDA
APESVIEYDGYAFKVKDIDSHHILFIEVKKAE
Download sequence
Identical sequences A0A0H3E5N5
WP_013390599.1.100936 WP_013390599.1.10353 WP_013390599.1.15971 WP_013390599.1.16994 WP_013390599.1.30485 WP_013390599.1.32777 WP_013390599.1.39473 WP_013390599.1.39900 WP_013390599.1.40255 WP_013390599.1.59507 WP_013390599.1.62747 WP_013390599.1.68581 WP_013390599.1.69262 WP_013390599.1.70004 WP_013390599.1.72589 WP_013390599.1.72801 WP_013390599.1.7305 WP_013390599.1.7508 WP_013390599.1.79721 WP_013390599.1.94463 WP_013390599.1.99425 gi|311069077|ref|YP_003974000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]